PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g090760.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GATA
Protein Properties Length: 261aa    MW: 29246 Da    PI: 6.8357
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g090760.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.8e-18167201135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Sopim01g090760.0.1 167 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 201
                         *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.9E-841252IPR016679Transcription factor, GATA, plant
SMARTSM004018.2E-16161211IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.503161197IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.8E-15162225No hitNo description
Gene3DG3DSA:3.30.50.108.0E-14165199IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.27E-14166213No hitNo description
PfamPF003206.9E-16167201IPR000679Zinc finger, GATA-type
PROSITE patternPS003440167192IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MDVYGLHSAP DLFRIDDLLD FSNDEIFSIN NNSNNTDSNH HHQPHSHNSS AAGPANYYDA  60
LLPNSSDDFT DNLCVPSDDV AELEWLSNFV EDSFSNFPAN SVTGTMNITS NTASFHGRSR  120
SKRSRSTSSW TSSLQNSNAT TSVKNKESSV YTRERSSSMD EDVPRRCTHC ASEKTPQWRT  180
GPLGPKTLCN ACGVRYKSGR LVPEYRPAAS PTFVLTQHSN SHRKVMELRR QKEMIHQPQQ  240
QQQMPPSTEE GMYGHHFRVC *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117122RSRSKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004229778.10.0PREDICTED: GATA transcription factor 4
SwissprotO497411e-76GATA2_ARATH; GATA transcription factor 2
TrEMBLK4AZ170.0K4AZ17_SOLLC; Uncharacterized protein
STRINGSolyc01g090760.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.14e-66GATA transcription factor 4